Stenotrophomonas maltophilia D457: SMD_0852
Help
Entry
SMD_0852 CDS
T02061
Symbol
phoB
Name
(GenBank) Phosphate regulon transcriptional regulatory protein PhoB (SphR)
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
smz
Stenotrophomonas maltophilia D457
Pathway
smz02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
smz00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
SMD_0852 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
smz02022
]
SMD_0852 (phoB)
Two-component system [BR:
smz02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
SMD_0852 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Trans_reg_C
Response_reg
Motif
Other DBs
NCBI-ProteinID:
CCH11432
LinkDB
All DBs
Position
complement(967966..968655)
Genome browser
AA seq
229 aa
AA seq
DB search
MQKRILIVDDEPAIREMVAFALRKGDYEPVHAGDAREAQTAIADRVPDLILLDWMLPGTS
GLDLARRWRKETLTREVPIIMLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVM
RRAREDDEDGSVAVGPIRIDGAAHRVFANDQPVPIGPTEYRLLHFFMTHPERVYTRAQLL
DHVWGGSVYVEERTIDVHIRRLRKTLEPFNAENMVQTVRGAGYRFSTAT
NT seq
690 nt
NT seq
+upstream
nt +downstream
nt
gtgcagaaacgcatcctgatcgtcgatgacgagcccgcgatccgtgaaatggtcgccttc
gcccttcgcaagggcgattacgaaccggtccacgccggcgatgcccgggaggcccagacc
gcgatcgccgaccgcgttccggacctgatcctgctggactggatgctgcccggcaccagc
ggcctggacctggcccgtcgctggcgcaaggaaacgctgacccgcgaagtgccgatcatc
atgctgaccgcccgcggcgaggagaacgaccgcgtcggtggcctggaagccggcgtcgac
gactacgtggtcaagccgttctcggcgcgcgaactgctggcgcgcatccgtgcggtgatg
cgccgtgcccgcgaggacgacgaggacggcagcgtggcagtcggcccgatccgcatcgac
ggcgccgcccatcgcgtgttcgccaacgaccagccggtgccgatcggcccgaccgaatac
cgcctgctgcacttcttcatgacccatccggagcgcgtctacacccgcgcgcagctgctg
gaccatgtatggggtggcagcgtgtacgtggaggagcgcaccatcgacgtgcatatccgc
cgcctgcgcaagacgctggaaccgttcaacgccgagaacatggtgcagaccgtgcgcggc
gccggctaccggttctccactgccacctga
DBGET
integrated database retrieval system