KEGG   Stenotrophomonas maltophilia D457: SMD_1747
Entry
SMD_1747          CDS       T02061                                 
Symbol
coaD
Name
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00770  Pantothenate and CoA biosynthesis
smz01100  Metabolic pathways
smz01240  Biosynthesis of cofactors
Module
smz_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:smz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SMD_1747 (coaD)
Enzymes [BR:smz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     SMD_1747 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: CCH12293
LinkDB
Position
1921249..1921758
AA seq 169 aa
MTVANRRIAVYPGTFDPITNGHIDLVSRAAPLFEKVVVGVAQSPSKGPALPLEQRVQLAR
GALAHHGNVEVIGFDTLLAHFVRSVQGGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL
FLTPAEQHSFISSSLVREIARLGGDVSGFVPAAVLEALRKVREAKSAQS
NT seq 510 nt   +upstreamnt  +downstreamnt
atgaccgtggccaatcgccgcattgccgtctaccccggcacgttcgaccccatcaccaac
ggtcatatcgaccttgtgagccgggccgcaccgctgttcgaaaaggtcgtggtcggcgtg
gcgcagagcccgtccaagggcccggcgctgccgctggagcagcgcgtgcagctggcgcgt
ggcgcgctggcccaccacggcaacgtcgaggtcatcggcttcgataccctgctggcccat
ttcgtacgttcggtgcagggcggggtgctgctgcgcggcctgcgcgcggtgtccgacttc
gagtacgaattccagatggccagcatgaaccgccacctgatccccgaggtcgagaccctg
ttcctgaccccggccgagcagcacagcttcatttcgtcctcgctggtccgcgagatcgcg
cgcctgggcggcgacgtgtccggtttcgtgccggccgcggtgctcgaagccctgcgcaag
gtccgcgaagcgaagtcggcacagtcgtaa

DBGET integrated database retrieval system