Stenotrophomonas maltophilia D457: SMD_2857 Help Entry SMD_2857          CDS       T02061                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism smz  Stenotrophomonas maltophilia D457 Pathway smz00190   Oxidative phosphorylation smz01100   Metabolic pathways smz02020   Two-component system Module smz_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:smz00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SMD_2857  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SMD_2857 Enzymes [BR:smz01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      SMD_2857 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  CCH13387 LinkDB All DBs Position 3178607..3178723 Genome browser AA seq 38 aa AA seqDB search MWYFAWILGAGLASTVAILNGMWFEAREQNRIEKENRR NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggattctcggtgccggcctcgcctcgacggtggccatcctcaac ggcatgtggttcgaagcccgcgagcagaaccgcatcgagaaagaaaatcgtcgctga

DBGET integrated database retrieval system