Stenotrophomonas maltophilia D457: SMD_4105 Help Entry SMD_4105          CDS       T02061                                  Name (GenBank) Acyl carrier protein (ACP1)   KO K02078   acyl carrier protein Organism smz  Stenotrophomonas maltophilia D457 Pathway smz01100   Metabolic pathways smz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMD_4105    00074 Mycolic acid biosynthesis     SMD_4105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SMD_4105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CCH14611 LinkDB All DBs Position complement(4610972..4611229) Genome browser AA seq 85 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDPTAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALGEFVAARQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgcaagcacttgagcacgagatcaaggaattgatcatttcctccctttcgctggaggac atcacgccggaggacatcgatccgaccgcgccgctgttcgtcgagggcctcggcctggat tcgatcgacgcgctggaactgggcctggcgctgcagaagaagtacggtgtcagcctctcg gccgattcggaagaaacccgtcgccatttctccagcgtgcgcgcgctcggcgagttcgtc gccgcccgccagtcgtaa

DBGET integrated database retrieval system