Streptomonospora nanhaiensis: OUQ99_05030 Help Entry OUQ99_05030       CDS       T08686                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism snah  Streptomonospora nanhaiensis Brite KEGG Orthology (KO) [BR:snah00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     OUQ99_05030 Enzymes [BR:snah01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      OUQ99_05030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin Glrx-like GST_N_2 GST_N_3 DUF3088 Motif Other DBs NCBI-ProteinID:  WAE76490 LinkDB All DBs Position complement(1119301..1119561) Genome browser AA seq 86 aa AA seqDB search MTSTATEQFTMYTTPWCGYCKRLKSQLSREGITGGEVNIEEHPEAADLVMKVNGGNQTVP TLVFSDGSAMTNPSLAQVKKKLAELS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacgagtacggcgaccgaacagttcacgatgtacaccaccccctggtgcgggtactgc aagcggctcaagagccagctctcccgcgaggggatcaccggcggtgaggtgaacatcgag gagcacccggaggccgccgacctcgtcatgaaggtcaacggcggcaaccagacggtgccg acgctggtcttcagcgacgggtcggcgatgacgaacccgtcgctcgctcaggtgaagaag aagctggccgagctgtcgtag

DBGET integrated database retrieval system