Streptomonospora nanhaiensis: OUQ99_09475 Help Entry OUQ99_09475       CDS       T08686                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism snah  Streptomonospora nanhaiensis Pathway snah00998   Biosynthesis of various antibiotics snah01100   Metabolic pathways snah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snah00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OUQ99_09475    00074 Mycolic acid biosynthesis     OUQ99_09475   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OUQ99_09475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF5031 PP-binding_2 Motif Other DBs NCBI-ProteinID:  WAE75281 LinkDB All DBs Position complement(2165155..2165397) Genome browser AA seq 80 aa AA seqDB search MAAHSEQEILTGLGEIVEEIVGTEPAEVTPEKSFVDDLDIDSLSMVEIAIAAQDKFGVEI PDDQLKDLKTVQDVINFIQK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcggctcacagcgagcaggagatcctgaccggcctcggcgagatcgtcgaggagatc gtcggcaccgagcccgccgaggtcaccccggagaagagcttcgtggacgacctcgacatc gactcgctgtccatggtggagatcgccatcgccgcccaggacaagttcggcgtggagatc ccggacgaccagctcaaggacctcaagacggtccaggacgtcatcaacttcatccagaag tag

DBGET integrated database retrieval system