Sphingomonas naphthae: PQ455_05150 Help Entry PQ455_05150       CDS       T08850                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism snap  Sphingomonas naphthae Pathway snap01100   Metabolic pathways snap01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snap00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PQ455_05150    00074 Mycolic acid biosynthesis     PQ455_05150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PQ455_05150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  WCT74620 LinkDB All DBs Position 1089190..1089426 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKISTVKDAISYIDANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacaccgcagagcgcgtgaagaagatcgttgtcgagcatctcggcgtcgaggcg gacaaggtcaccgaggaagcgagcttcatcgacgatctgggtgccgacagcctcgacatc gtcgagctggtaatggcgttcgaggaagagttcggcgtggaaatccccgacgacgcggcc gagaagatcagcaccgtcaaggatgccatcagctacatcgacgccaacaagggctga

DBGET integrated database retrieval system