Sphingomonas naphthae: PQ455_14160 Help Entry PQ455_14160       CDS       T08850                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism snap  Sphingomonas naphthae Pathway snap01100   Metabolic pathways snap01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snap00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PQ455_14160    00074 Mycolic acid biosynthesis     PQ455_14160   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PQ455_14160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF2827 Motif Other DBs NCBI-ProteinID:  WCT72772 LinkDB All DBs Position complement(2949189..2949422) Genome browser AA seq 77 aa AA seqDB search MSDTFARIAELIEPFNKKGVSLSDSTTFAGDLEWDSLTVMDFVAAVEDEFDILITMNMQA EIETVGQLVAAVEKLQA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccttcgcccgcatcgccgagctgatcgaacccttcaacaagaagggcgtc tcgctgagcgattccaccaccttcgccggtgatctcgaatgggacagcctgacggtgatg gatttcgtcgccgccgtggaggatgagttcgacatcctcatcacgatgaacatgcaggcc gagatcgagacggtgggccagctcgtcgccgccgtggagaagctccaggcatga

DBGET integrated database retrieval system