Sneathiella marina: NBZ79_06445 Help Entry NBZ79_06445       CDS       T08200                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism snea  Sneathiella marina Pathway snea00998   Biosynthesis of various antibiotics snea01100   Metabolic pathways snea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NBZ79_06445    00074 Mycolic acid biosynthesis     NBZ79_06445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NBZ79_06445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 MID51-like_C Motif Other DBs NCBI-ProteinID:  USG62614 LinkDB All DBs Position 1347665..1347913 Genome browser AA seq 82 aa AA seqDB search MMTREEVYNSLSEYLRDLFEVPAENITPDAKLYEDLDLDSIDAVDLVVKLQDLTNKKIPP EEFKTVRTVDDVVDRVYALLED NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgatgacgcgtgaagaagtatataatagtttaagcgaataccttcgggatttgtttgag gtgcccgcagaaaatataaccccggatgcaaagttgtatgaggatcttgatctagacagc atcgatgcagtcgatctggtcgtcaaactgcaggatttgaccaataagaaaataccacct gaagaattcaagacggtgcgaacggtcgatgacgtcgtggaccgcgtttatgcgttattg gaagactaa

DBGET integrated database retrieval system