Serratia nematodiphila: NLX84_16345 Help Entry NLX84_16345       CDS       T08619                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism snem  Serratia nematodiphila Pathway snem01100   Metabolic pathways snem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NLX84_16345    00074 Mycolic acid biosynthesis     NLX84_16345   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NLX84_16345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UTN99979 LinkDB All DBs Position 3433496..3433756 Genome browser AA seq 86 aa AA seqDB search MLNRDAVMDYILTCLQGIVEGGVEIKPDSDLVNDLGLESIRVLDLLMMLEDELDISIPIN ILLDVRTPEQLLDALRPYLEKNHGTV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctaaatcgcgatgctgtaatggattatatcctgacgtgtttgcaaggtatcgtcgaa ggcggagtggaaataaaacctgatagcgatctcgtcaatgatcttggcctggaatccatc agagtcttggatctgcttatgatgctggaagatgaattagatatctccattcctatcaat atattgcttgatgtcagaacgcctgagcaactgcttgacgcgctgcgcccttatctggag aaaaaccatgggactgtatga

DBGET integrated database retrieval system