Serratia nevei: OI978_01735
Help
Entry
OI978_01735 CDS
T09395
Symbol
phoB
Name
(GenBank) phosphate response regulator transcription factor PhoB
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
snev
Serratia nevei
Pathway
snev02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
snev00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
OI978_01735 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
snev02022
]
OI978_01735 (phoB)
Two-component system [BR:
snev02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
OI978_01735 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Trans_reg_C
Response_reg
Peripla_BP_5
Response_reg_2
Motif
Other DBs
NCBI-ProteinID:
WIJ64755
LinkDB
All DBs
Position
complement(350135..350824)
Genome browser
AA seq
229 aa
AA seq
DB search
MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRLSEPFPDLVLLDWMLPGGS
GIQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM
RRISPMAVEEVIEMQGLSLDPSSHRVMANDQALDMGPTEFKLLHFFMTHPERVYSREQLL
NHVWGTNVYVEDRTVDVHIRRLRKALETSGHDKMVQTVRGTGYRFSTRY
NT seq
690 nt
NT seq
+upstream
nt +downstream
nt
atggcaagacgcatactggtggtggaagacgaagcgccgatccgtgagatggtgtgcttt
gtgttggaacagaatggttaccaaccgttggaagccgaggattatgacagcgccgtgacg
cgcctgtctgagccgttccctgatttggtgttgctcgactggatgttgcccggcggttcc
ggcattcagtttatcaaacatatgaagcgcgaagcgctgacccgcgatattccggtcatg
atgctgaccgcgcgcggcgaagaggaagaccgcgtgcgcggcctggaagtgggggcggat
gattatatcaccaagccgttctcgcccaaggagctggtggcgcgcatcaaggcggtcatg
cgccgcatttcaccgatggcggtggaagaagtgattgaaatgcaagggctgagcctggat
ccgtcctcccaccgcgtgatggctaacgatcaggcgttggacatggggccgaccgagttc
aagctgctgcacttctttatgacccacccagagcgggtttatagccgtgagcagttgctt
aatcacgtctggggcactaacgtttatgtggaagaccgtaccgttgacgtgcatatccgt
cggctccgcaaggcgttagaaaccagtgggcatgataaaatggttcaaaccgttcggggc
accggctaccggttctcaacgcgctactga
DBGET
integrated database retrieval system