Streptomyces nojiriensis: JYK04_05307 Help Entry JYK04_05307       CDS       T07326                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism snf  Streptomyces nojiriensis Pathway snf00074   Mycolic acid biosynthesis snf00280   Valine, leucine and isoleucine degradation snf00630   Glyoxylate and dicarboxylate metabolism snf00640   Propanoate metabolism snf01100   Metabolic pathways snf01110   Biosynthesis of secondary metabolites snf01120   Microbial metabolism in diverse environments snf01200   Carbon metabolism Module snf_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:snf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     JYK04_05307    00640 Propanoate metabolism     JYK04_05307   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     JYK04_05307   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     JYK04_05307 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  QTI47458 LinkDB All DBs Position complement(5631245..5631454) Genome browser AA seq 69 aa AA seqDB search MVIKVVKGNPTPEELAAALAVVQARAAVLAMAPSGAPPVADEWSAPARVARRRVPRPGPR AWGRTYWPA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtggtgatcaaggtcgtcaagggcaacccgaccccggaggagctggccgccgcactggcg gtggtccaagcgcgcgcggcggtgctggccatggccccgtcgggcgctccgccggtcgcg gacgagtggtcggcgccggcccgggtggcccggcggcgggttccgcgtccggggccgcgg gcctggggccgtacgtactggcccgcgtag

DBGET integrated database retrieval system