Salvelinus namaycush (lake trout): 120018013 Help Entry 120018013         CDS       T07522                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism snh  Salvelinus namaycush (lake trout) Pathway snh03082   ATP-dependent chromatin remodeling snh04217   Necroptosis Brite KEGG Orthology (KO) [BR:snh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120018013  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120018013  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:snh03036]     120018013   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120018013 Chromosome and associated proteins [BR:snh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120018013 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120018013 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  120018013 NCBI-ProteinID:  XP_038816897 UniProt:  A0A8U0P1Y8 LinkDB All DBs Position Sna2:72440723..72441127 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAVKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagcggaagaggcaaaaccggaggcaaggccagggcgaaggcaaagacacgttcatcc cgtgccggactccagttccccgtgggccgtgtgcacaggctgctgcgcaaaggcaactac gccgagcgtgtgggcgctggcgcaccagtgtacctggccgcagtgctcgagtacctgact gctgagatcctggagttggccggcaacgctgcccgtgacaacaagaagacccgtatcatc ccccgtcacctgcagctggccgtccgtaacgacgaggagctgaacaaactgcttggcggc gtgaccatcgctcagggtggtgtgctacccaacatccaggcagtgctgctccccaagaag actgagaaggccgtcaaagccaagtaa

DBGET integrated database retrieval system