Salvelinus namaycush (lake trout): 120019900 Help Entry 120019900         CDS       T07522                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism snh  Salvelinus namaycush (lake trout) Brite KEGG Orthology (KO) [BR:snh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:snh03041]     120019900   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:snh04052]     120019900 Spliceosome [BR:snh03041]  Complex B   Other components    Complex B specific factors     120019900 Cytokines and neuropeptides [BR:snh04052]  Neuropeptides   Unclassified    120019900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  120019900 NCBI-ProteinID:  XP_038819242 UniProt:  A0A8U0P6Q0 LinkDB All DBs Position Sna2:complement(80347101..80350718) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVSLGDY EIHDGQNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtttgcaatgaccggctgggcaagaaggtccgggtgaagtgcaactca gaagacactataggagacctgaagaagctcatcgctgcccagacaggcacacggtgggac aagatcgtactcaagaaatggtacaccatattcaaggaccacgtgtctctgggagactat gagatccatgatgggcagaacctggagctgtactaccagtag

DBGET integrated database retrieval system