Salvelinus namaycush (lake trout): 120020599 Help Entry 120020599         CDS       T07522                                  Symbol pfn2l Name (RefSeq) profilin 2 like isoform X1   KO K05759   profilin Organism snh  Salvelinus namaycush (lake trout) Pathway snh04810   Regulation of actin cytoskeleton snh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:snh00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120020599 (pfn2l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120020599 (pfn2l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:snh04131]     120020599 (pfn2l)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:snh04812]     120020599 (pfn2l)    04147 Exosome [BR:snh04147]     120020599 (pfn2l) Membrane trafficking [BR:snh04131]  Others   Actin-binding proteins    Others     120020599 (pfn2l) Cytoskeleton proteins [BR:snh04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      120020599 (pfn2l) Exosome [BR:snh04147]  Exosomal proteins   Proteins found in most exosomes    120020599 (pfn2l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  120020599 NCBI-ProteinID:  XP_038820233 UniProt:  A0A8U0TLQ0 LinkDB All DBs Position Sna25:33949320..33957132 Genome browser AA seq 139 aa AA seqDB search MSWQSYVDNLMADGSCQDSAIVGYTDAKYVWAAHAGGTFNNITPQEIDVLIGKDRASFFT NGMTLGSKKCSVIRDSLHNEGDWTMDIRTKSQGGEPTYNVTVGKAGKALVLVMGKEGVHG GQLNKKAFTMAEYLRKSGS NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgtcttggcaaagctacgtggataacctgatggcggatggcagctgtcaggattccgcc attgttgggtatacggacgccaaatacgtttgggcagcacatgccggtggtacttttaac aacataacgcctcaagaaattgatgtcctcattggaaaggacagagctagcttcttcacc aacggcatgaccttgggttcgaagaagtgctcggtcatcagagacagcctccataatgaa ggggactggacaatggacatcaggacaaagagtcaaggaggagagccaacatacaacgtt actgtaggcaaagccggaaaagcattggttttagtcatgggaaaagaaggggtccatgga ggacaactcaacaagaaagcatttactatggctgagtacctgaggaagtctggatcttaa

DBGET integrated database retrieval system