Salvelinus namaycush (lake trout): 120021230 Help Entry 120021230         CDS       T07522                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism snh  Salvelinus namaycush (lake trout) Pathway snh04137   Mitophagy - animal snh04140   Autophagy - animal snh04144   Endocytosis snh04145   Phagosome snh04148   Efferocytosis snh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:snh00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120021230    04145 Phagosome     120021230    04140 Autophagy - animal     120021230    04137 Mitophagy - animal     120021230    04148 Efferocytosis     120021230  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120021230  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:snh04131]     120021230   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120021230    04031 GTP-binding proteins [BR:snh04031]     120021230 Membrane trafficking [BR:snh04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120021230 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120021230   Exosomal proteins of other body fluids (saliva and urine)    120021230   Exosomal proteins of colorectal cancer cells    120021230   Exosomal proteins of bladder cancer cells    120021230 GTP-binding proteins [BR:snh04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120021230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 PduV-EutP nSTAND3 Septin AAA_16 DUF5992 NTPase_1 AAA_7 AAA_22 AAA_24 G-alpha AAA_5 SRPRB ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  120021230 NCBI-ProteinID:  XP_038820827 UniProt:  A0A8U0P8Z1 LinkDB All DBs Position Sna26:10596311..10603907 Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTTKRAQAWCASKNSIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPAAPSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctcccgtaagaaggtgctgctgaaggtgatcatcctcggagactctggggtaggg aagacttctctgatgaaccagtatgtaaataagaagttcagtaaccagtacaaggccact ataggagctgacttcctcaccaaggaggtgatggtggacgacaggctggtcaccatgcag atctgggatacggcggggcaggagcggttccagtctctgggcgtggcgttctaccgcggc gctgactgctgtgtgctggtctacgacgtcacggcgcccaacaccttcaagacactggac agctggagggatgagttcctgatccaggccagccccagagacccagacaacttccccttt gtggtgctaggcaacaagattgacctcgagaacagacaggtgacgacaaaacgtgcccag gcctggtgtgccagtaagaacagcatcccgtactttgagaccagcgccaaggaggccatc aacgtagaccaagcattccagaccattgcccgcaatgcccttaaacaggagtctgaggtg gagacgtatgacttcccagaccagatcaaactgagagacgaccggcctgccgcccccagc gacggctgctcctgctga

DBGET integrated database retrieval system