Salvelinus namaycush (lake trout): 120025782 Help Entry 120025782         CDS       T07522                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism snh  Salvelinus namaycush (lake trout) Pathway snh04137   Mitophagy - animal snh04140   Autophagy - animal snh04144   Endocytosis snh04145   Phagosome snh04148   Efferocytosis snh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:snh00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120025782    04145 Phagosome     120025782    04140 Autophagy - animal     120025782    04137 Mitophagy - animal     120025782    04148 Efferocytosis     120025782  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120025782  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:snh04131]     120025782   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120025782    04031 GTP-binding proteins [BR:snh04031]     120025782 Membrane trafficking [BR:snh04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120025782 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120025782   Exosomal proteins of other body fluids (saliva and urine)    120025782   Exosomal proteins of colorectal cancer cells    120025782   Exosomal proteins of bladder cancer cells    120025782 GTP-binding proteins [BR:snh04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120025782 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 nSTAND3 PduV-EutP AAA_16 NTPase_1 Septin AAA_22 AAA_24 AAA_7 DUF5992 AAA_5 ATPase_2 SRPRB NACHT ABC_tran NB-ARC AAA_14 ATP-synt_ab Motif Other DBs NCBI-GeneID:  120025782 NCBI-ProteinID:  XP_038826353 UniProt:  A0A8U0TSC0 LinkDB All DBs Position Sna31:14676496..14680898 Genome browser AA seq 204 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKRFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTTKRAQAWCASKNNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPSSSDGCSC NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcctcccgtaagaaggtgctgctgaaggtgatcatcctcggagactctggggtaggg aagacatcgctgatgaaccagtatgtaaataagaggttcagtaaccaatacaaggccact ataggagctgacttcctcaccaaggaggtgatggtggatgacaggcttgtcaccatgcag atctgggacacggcagggcaggagcggtttcaatctctgggtgtggcgttctaccgtggg gctgactgctgtgtgctggtctatgatgtcacggcgcccaacacctttaagactctggac agttggagggatgagttcctgatccaggccagccccagagacccagataacttccccttt gtggtgctaggcaacaagattgacctcgagaacagacaggtgacgacaaagcgtgcccag gcctggtgtgccagtaagaacaacatcccctactttgagaccagtgccaaggaagccatc aacgtagaccaagcattccagaccatcgcccgcaacgccctcaaacaggagtctgaggtg gagacgtatgacttcccagaccagatcaaactgagagacgatcggccctcctccagcgac ggctgctcctgctga

DBGET integrated database retrieval system