Salvelinus namaycush (lake trout): 120027194 Help Entry 120027194         CDS       T07522                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism snh  Salvelinus namaycush (lake trout) Pathway snh04382   Cornified envelope formation snh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:snh00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     120027194  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120027194  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120027194 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of microglial cells    120027194 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 DAXX_hist_bd NNH2 Bcl-2 DEK_C EH Motif Other DBs NCBI-GeneID:  120027194 NCBI-ProteinID:  XP_038828010 UniProt:  A0A8U0PNK0 LinkDB All DBs Position Sna32:2416677..2418689 Genome browser AA seq 99 aa AA seqDB search MPSELERAMESMITVFHKYAAKEGNGNTLSRRELRDLMENELSGFLKSQKDPATVDKIMK DLDSNGDGEVNFEEFVSLVVGLSIACEQCYQMHKKKMGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccatcagaactggaacgagcaatggagtccatgatcactgtgttccacaagtatgct gctaaggagggcaatggcaacactctgagccgccgtgagctaagggacctgatggagaac gagctctctggcttcctcaagtctcagaaggacccagccacagtagacaagatcatgaag gatctggactctaatggtgatggagaggtgaactttgaggagtttgtttctctcgttgtg ggcctgtccatcgcctgtgaacagtgctaccagatgcacaagaagaagatggggaagtga

DBGET integrated database retrieval system