Salvelinus namaycush (lake trout): 120028354 Help Entry 120028354         CDS       T07522                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism snh  Salvelinus namaycush (lake trout) Pathway snh04814   Motor proteins snh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:snh00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     120028354 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120028354 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:snh03037]     120028354 (dynll2a)    04812 Cytoskeleton proteins [BR:snh04812]     120028354 (dynll2a) Cilium and associated proteins [BR:snh03037]  Motile cilia and associated proteins   Dynein arm    120028354 (dynll2a) Cytoskeleton proteins [BR:snh04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      120028354 (dynll2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  120028354 NCBI-ProteinID:  XP_038829500 UniProt:  A0A8U0PQQ7 LinkDB All DBs Position Sna34:18005418..18011775 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtaatcaagaatgctgacatgtctgaggacatgcagcaggac gcagtggactgtgctacccaggccatggagaagtacaatatagagaaggacattgcggcc tacataaagaaggaatttgacaagaagtataacccaacatggcattgcattgttgggagg aacttcggcagctacgtcactcatgagacaaagcatttcatctacttctatttggggcag gtggccatcctcctcttcaagtctggctga

DBGET integrated database retrieval system