Salvelinus namaycush (lake trout): 120030369 Help Entry 120030369         CDS       T07522                                  Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism snh  Salvelinus namaycush (lake trout) Pathway snh03082   ATP-dependent chromatin remodeling snh04217   Necroptosis Brite KEGG Orthology (KO) [BR:snh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120030369  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120030369  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:snh03036]     120030369   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120030369 Chromosome and associated proteins [BR:snh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120030369 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120030369 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  120030369 NCBI-ProteinID:  XP_038831683 UniProt:  A0A8U0PVM9 LinkDB All DBs Position Sna36:9610806..9612355 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKTKTKAISRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggtgggaaggcaggaaaagactccgggaagactaagacaaaggccatttcgcgc tcacagagggcgggtttgcagttccccgtgggtcgtattcacagacatctgaaatccaga acaacgagccatggtcgagttggcgcgactgcagctgtctacagcgcggctattcttgaa tacctaactgctgaggttctggagctggcaggaaacgcatcaaaggatctgaaggtcaaa cgtatcactccacgtcacttgcaactggccattagaggcgatgaggagttggattctctc atcaaagcaaccattgctggtggtggtgtcatccctcatatccataagtcactgattgga aagaagggacagcagaagactgtataa

DBGET integrated database retrieval system