Salvelinus namaycush (lake trout): 120031267 Help Entry 120031267         CDS       T07522                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism snh  Salvelinus namaycush (lake trout) Pathway snh04382   Cornified envelope formation snh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:snh00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     120031267  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120031267  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120031267 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of microglial cells    120031267 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 DEK_C DAXX_hist_bd EH Astro_p19 Motif Other DBs NCBI-GeneID:  120031267 NCBI-ProteinID:  XP_038832872 UniProt:  A0A8U0PXG4 LinkDB All DBs Position Sna37:25627405..25631052 Genome browser AA seq 101 aa AA seqDB search MPSQLERSMQSLITVFHRYADKDGDCNTLSKKELKELMQTELGSFLKSQKDPAAIDTIMK NLDQNGDGKVNFEEFVSLVVGLSIACEQIYQLYTQKVAAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagttggagagatccatgcagtccctgatcacggtgttccatcgctatgcc gacaaggacggtgactgtaacacactgagcaaaaaggagctgaaagaactcatgcagaca gaactgggcagcttcctgaagtcccagaaggacccagccgccatagacacgatcatgaag aatctggaccagaatggtgatgggaaggtgaactttgaggagtttgtctctctggtggtg ggcctctccatcgcctgtgaacagatctaccagctctacacccagaaggttgctgccaag aaatga

DBGET integrated database retrieval system