Salvelinus namaycush (lake trout): 120035009 Help Entry 120035009         CDS       T07522                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism snh  Salvelinus namaycush (lake trout) Pathway snh03030   DNA replication snh03410   Base excision repair snh03420   Nucleotide excision repair snh03430   Mismatch repair snh03440   Homologous recombination Brite KEGG Orthology (KO) [BR:snh00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     120035009 (pold4)    03410 Base excision repair     120035009 (pold4)    03420 Nucleotide excision repair     120035009 (pold4)    03430 Mismatch repair     120035009 (pold4)    03440 Homologous recombination     120035009 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:snh03032]     120035009 (pold4)    03400 DNA repair and recombination proteins [BR:snh03400]     120035009 (pold4) DNA replication proteins [BR:snh03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     120035009 (pold4) DNA repair and recombination proteins [BR:snh03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       120035009 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      120035009 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  120035009 NCBI-ProteinID:  XP_038837679 UniProt:  A0A8U0Q998 LinkDB All DBs Position Sna42:complement(6260533..6262632) Genome browser AA seq 110 aa AA seqDB search MTAKRAALITDSYKVVKRSRREEKREKRAPSPPQKDTEPRPLTAREIELQELRQFDQDWR YGPCTGISRLQRWERAAQHGLNPPQEIRDMLLSADIDSDYTHCLWSDYPL NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgacggccaaacgtgcagctctcatcaccgactcctacaaggtggtaaagagatccagg agagaggagaagagagagaagagggccccatcgcctccccagaaggacactgagccgcgc cccctcacggccagagagatagagctgcaggagctgaggcagtttgaccaggactggcgg tatggaccctgcacaggtatcagtcgcttacagcggtgggagagagctgcacagcatggg ttaaacccccctcaggagatcagagatatgctgcttagcgcagacatagactcggactac acacactgcctgtggagtgactatccattgtga

DBGET integrated database retrieval system