Salvelinus namaycush (lake trout): 120038654 Help Entry 120038654         CDS       T07522                                  Name (RefSeq) YY1-associated factor 2-like   KO K11468   YY1-associated factor 2 Organism snh  Salvelinus namaycush (lake trout) Pathway snh03083   Polycomb repressive complex Brite KEGG Orthology (KO) [BR:snh00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     120038654  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:snh03036]     120038654 Chromosome and associated proteins [BR:snh03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      120038654     Noncanonical PRC1 (PRC1.3/1.5)      120038654     Noncanonical PRC1 (PRC1.6)      120038654 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_ribbon_RanBP C1_2 Ephrin_rec_like Motif Other DBs NCBI-GeneID:  120038654 NCBI-ProteinID:  XP_038840244 UniProt:  A0A8U0QE93 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MGDKKSPTRPKRQPKPSAEEGNWDCSVCTYKNTAEAFKCMMCDVRKGTSTRKPRPVSQLV AQRVAPQFASPTLLPKKDKKDRTDQEKNDKEPTVKKNSHKKMR NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgggagacaagaagagtccaaccaggccgaagcgtcaaccaaagccttcggcggaagag ggaaattgggactgtagcgtttgcacatacaagaacaccgcggaggctttcaagtgcatg atgtgcgatgtaaggaaagggacgtcaacacggaagcctcgtcctgtctcccagctggtt gctcagcgggtagcgccgcagtttgcctcgcccacgctgctgcccaagaaggacaagaag gacagaacggaccaggagaagaatgacaaagagcccacagtgaagaagaacagccacaag aagatgaggtaa

DBGET integrated database retrieval system