Salvelinus namaycush (lake trout): 120041145 Help Entry 120041145         CDS       T07522                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism snh  Salvelinus namaycush (lake trout) Pathway snh04382   Cornified envelope formation snh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:snh00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     120041145  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120041145  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120041145 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of microglial cells    120041145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 NNH2 DAXX_hist_bd Bcl-2 EH Motif Other DBs NCBI-GeneID:  120041145 NCBI-ProteinID:  XP_038842030 UniProt:  A0A8U0U794 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MPSELERAMESMITVFHRYAAKEGSSNTLSRRELKDLMENELSGFLKSQKDPATVDKIMK DLDSNGDGEVNFEEFVSLVVGLSIACEQCYQMHKKKMGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccgtcagaactggaacgtgccatggagtccatgatcaccgtgttccacaggtatgct gctaaggaaggcagtagcaacactttgagccgccgtgagctcaaggacctgatggagaac gagctctctggcttcctcaagtctcagaaggacccagccacagtagacaagatcatgaag gatctggactctaatggtgatggagaggtgaactttgaggagtttgtttctctggttgtg ggcctgtccatcgcctgtgaacagtgctaccagatgcacaagaagaagatggggaagtga

DBGET integrated database retrieval system