Salvelinus namaycush (lake trout): 120044603 Help Entry 120044603         CDS       T07522                                  Name (RefSeq) permeability factor 2-like   KO K10030   interleukin 8 Organism snh  Salvelinus namaycush (lake trout) Pathway snh04060   Cytokine-cytokine receptor interaction snh04218   Cellular senescence snh04620   Toll-like receptor signaling pathway snh04621   NOD-like receptor signaling pathway snh04622   RIG-I-like receptor signaling pathway snh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:snh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120044603  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120044603  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120044603    04621 NOD-like receptor signaling pathway     120044603    04622 RIG-I-like receptor signaling pathway     120044603  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120044603  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:snh04052]     120044603    00536 Glycosaminoglycan binding proteins [BR:snh00536]     120044603 Cytokines and neuropeptides [BR:snh04052]  Cytokines   Chemokines    120044603 Glycosaminoglycan binding proteins [BR:snh00536]  Heparan sulfate / Heparin   Chemokines    120044603 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  120044603 NCBI-ProteinID:  XP_038845202 UniProt:  A0A8U0QKX2 LinkDB All DBs Position 3:complement(75830799..75832648) Genome browser AA seq 97 aa AA seqDB search MSIRMSASLVVVLLALLTITEGMSLRGVGADLRCRCIETESRHIGKLIKKIEMFPPSSHC RDTEIIATLSKSGQEICLDVSAPWVKRVIEKMLANNK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagaatgtcagccagccttgtcgttgtgctcctggccctcctgaccattact gaggggatgagtctgagaggcgtgggggctgacctgcgatgtcgctgcattgagacggag agcagacatattggtaaactcattaagaagatagagatgttccctcccagctcgcactgc agagacactgagatcattgccactctgagcaagagtggtcaggagatttgtctggatgtc agcgctccttgggtcaagagggtcattgagaagatgctggccaacaacaaatga

DBGET integrated database retrieval system