Salvelinus namaycush (lake trout): 120045553 Help Entry 120045553         CDS       T07522                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism snh  Salvelinus namaycush (lake trout) Pathway snh04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:snh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     120045553  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:snh04121]     120045553    03400 DNA repair and recombination proteins [BR:snh03400]     120045553 Ubiquitin system [BR:snh04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      120045553    Cul5 complex      120045553 DNA repair and recombination proteins [BR:snh03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      120045553 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  120045553 NCBI-ProteinID:  XP_038846383 UniProt:  A0A8U0QNL6 LinkDB All DBs Position Sna4:26186849..26188941 Genome browser AA seq 114 aa AA seqDB search MIRRQKTTIFTDAKESTTFYELKRIVEGILKREPEEQRLFKVSQLLEDSKTLGDCGFTNQ TARPQAPGTVGLAFRMGDEMFEQLQVEAFSSPPELPDVMKPQDSGSTANEQTVQ NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgatccggcgtcagaagaccaccattttcacagacgccaaagagtccaccaccttctac gagctgaagcgcattgtcgagggaattctcaagagagagcctgaggaacagaggctcttc aaggtatcacagttgctagaagacagtaaaactcttggcgattgcggcttcaccaaccag actgcaagacctcaggccccaggcactgttggactggctttccgaatgggtgatgagatg tttgagcagctgcaggtggaggcattctccagccctccagagctccctgacgtcatgaag ccccaagactctggcagcactgccaacgaacagactgtgcagtga

DBGET integrated database retrieval system