Salvelinus namaycush (lake trout): 120047715 Help Entry 120047715         CDS       T07522                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism snh  Salvelinus namaycush (lake trout) Pathway snh04068   FoxO signaling pathway snh04136   Autophagy - other snh04140   Autophagy - animal snh04621   NOD-like receptor signaling pathway snh04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:snh00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     120047715  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120047715    04136 Autophagy - other     120047715  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120047715    04622 RIG-I-like receptor signaling pathway     120047715  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:snh04131]     120047715    04121 Ubiquitin system [BR:snh04121]     120047715    03029 Mitochondrial biogenesis [BR:snh03029]     120047715 Membrane trafficking [BR:snh04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     120047715 Ubiquitin system [BR:snh04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    120047715 Mitochondrial biogenesis [BR:snh03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     120047715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 XendoU Motif Other DBs NCBI-GeneID:  120047715 NCBI-ProteinID:  XP_038849197 UniProt:  A0A8U0QTC5 LinkDB All DBs Position Sna5:complement(63400259..63403668) Genome browser AA seq 120 aa AA seqDB search MSDNAESPTETQKDEPPTPQQPTEDSGTADEKKKIDVLLKAVGDTPIMKTKKWSVEKGRT VQSLSQFISRFLKMEANEQLFIYVNQSFSPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacgcagagtcccctacagaaacgcaaaaagatgagcctccaaccccacaa cagcctacggaagactcggggacggcagacgagaagaaaaaaattgatgtgttgttgaag gcagtaggagacacccccatcatgaagacaaagaaatggtcagtagagaaagggaggaca gtgcaatcactctctcagttcatctctcggttcctcaagatggaggccaatgaacagctg ttcatttacgtcaaccagtcattctctccctcgcctgatcaggaagtaggagtcctgttt gaatgttttggcagcgatgggaagcttgttctacattattgtaaatctcaagcctgggga taa

DBGET integrated database retrieval system