Salvelinus namaycush (lake trout): 120047744 Help Entry 120047744         CDS       T07522                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism snh  Salvelinus namaycush (lake trout) Pathway snh04382   Cornified envelope formation snh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:snh00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     120047744  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120047744  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120047744 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of microglial cells    120047744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EH Astro_p19 DEK_C HalOD1 Motif Other DBs NCBI-GeneID:  120047744 NCBI-ProteinID:  XP_038849229 UniProt:  A0A8U0QWF7 LinkDB All DBs Position Sna5:complement(65858053..65860138) Genome browser AA seq 101 aa AA seqDB search MPSQLESSMESLITVFHRYADKDGDCNTLSKKELKELMQTELASFLKSQKDPAAIDKIMK DLDQNGDGKVSFEEFVSLVVGLSIACEQIYQLHTKKVAAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagttggagagttccatggagtccctgatcacggtgttccatcgctatgcc gacaaggacggtgactgtaacacactgagcaagaaggagctgaaagaactgatgcagaca gaactggccagcttcctgaagtcccagaaggacccagccgccatagacaagatcatgaag gatctggaccagaatggtgatgggaaggtgagctttgaggagtttgtctctctggtggtg ggcctctccatcgcctgtgaacagatctaccagctccacaccaagaaggttgctgccaag aagtga

DBGET integrated database retrieval system