Salvelinus namaycush (lake trout): 120052736 Help Entry 120052736         CDS       T07522                                  Name (RefSeq) ras-related protein R-Ras-like   KO K07830   Ras-related protein R-Ras2 Organism snh  Salvelinus namaycush (lake trout) Pathway snh04010   MAPK signaling pathway snh04137   Mitophagy - animal snh04140   Autophagy - animal snh04218   Cellular senescence snh04371   Apelin signaling pathway snh04625   C-type lectin receptor signaling pathway snh04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:snh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120052736    04371 Apelin signaling pathway     120052736  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120052736    04137 Mitophagy - animal     120052736   09143 Cell growth and death    04218 Cellular senescence     120052736   09142 Cell motility    04810 Regulation of actin cytoskeleton     120052736  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120052736  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120052736    04031 GTP-binding proteins [BR:snh04031]     120052736 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120052736   Exosomal proteins of bladder cancer cells    120052736 GTP-binding proteins [BR:snh04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120052736 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  120052736 NCBI-ProteinID:  XP_038855748 UniProt:  A0A8U0R4M3 LinkDB All DBs Position Sna8:complement(45624538..45638345) Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLDQSRVISREEAQGFARENRIHYMEASAKNRYNVDEAFLEVVRAIRKFQETESPPLP ANHTGKRKSGGCPCILL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgaggaggagagattcaaactggtcgtcgtgggcgggggaggtgtggggaaa agcgccttgaccatacaattcatccagtcatactttgtatcggattatgacccaaccatc gaggactcctacaccaaaatatgcacagtggatgggaaagagacacgattagacatcttg gacacagcaggtcaagaggagtttggtgcaatgagggagcagtacatgcgctcaggagaa ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac aaggctgacctggaccagtcgagagtgatctccagagaggaggcccagggctttgccaga gagaacaggatccattacatggaggcctcggctaagaaccgctacaacgtagacgaagcc ttcctggaggtggtgcgagctataagaaagtttcaggagactgagagtccccctctacct gcaaaccacacaggaaaacggaagagcggtggctgcccctgcatcctcctttaa

DBGET integrated database retrieval system