Salvelinus namaycush (lake trout): 120056939
Help
Entry
120056939 CDS
T07522
Name
(RefSeq) S-phase kinase-associated protein 1 isoform X1
KO
K03094
S-phase kinase-associated protein 1
Organism
snh
Salvelinus namaycush (lake trout)
Pathway
snh03083
Polycomb repressive complex
snh04110
Cell cycle
snh04114
Oocyte meiosis
snh04120
Ubiquitin mediated proteolysis
snh04141
Protein processing in endoplasmic reticulum
snh04310
Wnt signaling pathway
snh04350
TGF-beta signaling pathway
snh05132
Salmonella infection
Brite
KEGG Orthology (KO) [BR:
snh00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
120056939
04120 Ubiquitin mediated proteolysis
120056939
09126 Chromosome
03083 Polycomb repressive complex
120056939
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
120056939
04350 TGF-beta signaling pathway
120056939
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
120056939
04114 Oocyte meiosis
120056939
09160 Human Diseases
09171 Infectious disease: bacterial
05132 Salmonella infection
120056939
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
snh04131
]
120056939
04121 Ubiquitin system [BR:
snh04121
]
120056939
03036 Chromosome and associated proteins [BR:
snh03036
]
120056939
Membrane trafficking [BR:
snh04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
120056939
Ubiquitin system [BR:
snh04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
120056939
Cul7 complex
120056939
Chromosome and associated proteins [BR:
snh03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
120056939
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
120056939
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
120056939
NCBI-ProteinID:
XP_038861167
UniProt:
A0A8U1BXM7
LinkDB
All DBs
Position
Sna12:complement(14738245..14750173)
Genome browser
AA seq
174 aa
AA seq
DB search
MLRLRTFVRNGMPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPN
VNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANY
LDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq
525 nt
NT seq
+upstream
nt +downstream
nt
atgttgcggttgcgcacatttgtacggaatgggatgccaacaattaaactgcaaagttca
gatggggagatctttgaggtggatgtggaaatagcaaagcagtctgtgacaataaagaca
atgctggaagatttgggtatggatgatgaaggagatgatgatccagtccccctcccgaat
gtgaatgcggctatcctcaagaaggtgatccagtggtgcacccaccataaagatgatccc
cctccccctgaggatgacgagaacaaggagaaaaggacggatgacatacccgtctgggac
caggagttcctcaaagtggaccaagggaccctcttcgaacttattctagccgcaaactat
ttagacatcaaaggactgctagatgtcacctgcaagacggtggccaacatgatcaaagga
aagaccccagaggagatcaggaagacgttcaacatcaaaaatgacttcacagaggaagag
gaagcccaggtacgcaaggagaaccagtggtgtgaagagaaatag
DBGET
integrated database retrieval system