Salvelinus namaycush (lake trout): 120061378 Help Entry 120061378         CDS       T07522                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism snh  Salvelinus namaycush (lake trout) Pathway snh04137   Mitophagy - animal snh04140   Autophagy - animal snh04144   Endocytosis snh04145   Phagosome snh04148   Efferocytosis snh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:snh00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120061378    04145 Phagosome     120061378    04140 Autophagy - animal     120061378    04137 Mitophagy - animal     120061378    04148 Efferocytosis     120061378  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120061378  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:snh04131]     120061378   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120061378    04031 GTP-binding proteins [BR:snh04031]     120061378 Membrane trafficking [BR:snh04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120061378 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120061378   Exosomal proteins of other body fluids (saliva and urine)    120061378   Exosomal proteins of colorectal cancer cells    120061378   Exosomal proteins of bladder cancer cells    120061378 GTP-binding proteins [BR:snh04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120061378 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 AAA_16 Septin AAA_22 AAA_7 NTPase_1 AAA_24 AAA_5 ATPase_2 ABC_tran NACHT Motif Other DBs NCBI-GeneID:  120061378 NCBI-ProteinID:  XP_038867084 UniProt:  A0A8U1F036 LinkDB All DBs Position Sna2:30739467..30751562 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKTSAEACTC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctcctgaaagtcatcatcctgggggattctggagttggg aagacctccctgatgaaccagtatgtgaataggaagttcagtaaccagtacaaagctaca ataggagctgacttcctgaccaaggaggtgatggtggacgatcggctcgtcacaatgcag atctgggatacggcagggcaagagaggttccagtctctgggtgtggcgttctaccgtggg gcagactgctgtgtgctggtgtttgacgtaactgcccccaacaccttcaagactctagac agctggagggacgagttcctgatccaggccagtcccagagaccccgagaacttccccttt gtggtgctaggcaacaagatcgacctggagaacagacaggtgacgaccaagcgggctcag gcatggtgtcagagtaagaacaacatcccctactttgagaccagtgccaaggaggccatc aacgtagagcaggccttccagaccattgcacgcaatgccctcaaacaggagactgaggtg gagctgtataatgaattcccagagcccatcaagctagacaggaatgacagagcaaagact tcagcagaggcctgcacctgctga

DBGET integrated database retrieval system