Salvelinus namaycush (lake trout): 120065590 Help Entry 120065590         CDS       T07522                                  Name (RefSeq) calglandulin-like   KO K02183   calmodulin Organism snh  Salvelinus namaycush (lake trout) Pathway snh04020   Calcium signaling pathway snh04070   Phosphatidylinositol signaling system snh04114   Oocyte meiosis snh04218   Cellular senescence snh04261   Adrenergic signaling in cardiomyocytes snh04270   Vascular smooth muscle contraction snh04371   Apelin signaling pathway snh04625   C-type lectin receptor signaling pathway snh04744   Phototransduction snh04910   Insulin signaling pathway snh04912   GnRH signaling pathway snh04916   Melanogenesis Brite KEGG Orthology (KO) [BR:snh00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     120065590    04020 Calcium signaling pathway     120065590    04070 Phosphatidylinositol signaling system     120065590  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120065590    04218 Cellular senescence     120065590  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120065590   09152 Endocrine system    04910 Insulin signaling pathway     120065590    04912 GnRH signaling pathway     120065590    04916 Melanogenesis     120065590   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     120065590    04270 Vascular smooth muscle contraction     120065590   09157 Sensory system    04744 Phototransduction     120065590  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:snh01009]     120065590   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:snh04131]     120065590    03036 Chromosome and associated proteins [BR:snh03036]     120065590   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120065590 Protein phosphatases and associated proteins [BR:snh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120065590 Membrane trafficking [BR:snh04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     120065590 Chromosome and associated proteins [BR:snh03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      120065590 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120065590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 AIF-1 EF-hand_9 EH EF-hand_5 Motif Other DBs NCBI-GeneID:  120065590 NCBI-ProteinID:  XP_038872582 UniProt:  A0A8U1H8I2 LinkDB All DBs Position Sna20:13252417..13253755 Genome browser AA seq 154 aa AA seqDB search MENALLQEQITEYKGVFEMFDEEGNGTVKTQELERLMSLMVINPTKRELLQMAKDVDKDG KGTFNRESFLGLMALVHESARGQHAMLRAAFKVFEKEAEGYIEWNTLKYVLMNVGAPLNE LKAEQMMEADKDGDGSFDYEECVTMMTGGSFKMC NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggaaaatgctctattacaagaacagatcactgagtataaaggtgtttttgagatgttt gatgaggaaggaaatggaacagtgaagacacaggagctagagcgactgatgagtttaatg gtaatcaatcccaccaagagagagctccttcagatggccaaagatgtggacaaagatggc aaaggtacttttaaccgtgagagcttcctgggtttgatggcattggttcatgaaagcgcg aggggccaacatgctatgctacgagctgctttcaaggtgtttgagaaagaggccgaggga tatattgagtggaataccctgaagtatgtgttgatgaatgtaggagcaccactgaatgag ttaaaggcagagcaaatgatggaggcagataaagatggggatggaagcttcgattatgaa gaatgtgtgaccatgatgactggaggctccttcaagatgtgctaa

DBGET integrated database retrieval system