Sulfuriferula nivalis: SFSGTM_31230 Help Entry SFSGTM_31230      CDS       T06628                                  Symbol acpC Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sniv  Sulfuriferula nivalis Pathway sniv01100   Metabolic pathways sniv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sniv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SFSGTM_31230 (acpC)    00074 Mycolic acid biosynthesis     SFSGTM_31230 (acpC)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SFSGTM_31230 (acpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBP02415 UniProt:  A0A809RLX1 LinkDB All DBs Position complement(3271458..3271742) Genome browser AA seq 94 aa AA seqDB search MSDNHSTTDNSLFYPEIAALMVEALNLEISADEITLDAPLYGDGLGLDSIDVLEIALVVS KRYGLQLRADNADNQHIFSSLRNLTDYIAAHRSK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtcagacaaccactcaactactgataacagcctgttctatccagagatcgccgcactc atggtcgaagcgcttaatcttgaaatttctgccgacgagatcacgctggatgcaccacta tatggtgatggacttggtctggattctatagacgtgctcgaaatcgcactcgtggtatcc aaacgctatggcctgcagctacgcgcagacaacgcggataatcagcacatattcagctcg ttgcgcaatctgactgactacatcgcagcacatcgaagcaagtaa

DBGET integrated database retrieval system