Sphingomonas sp. NIC1: A7E77_00520 Help Entry A7E77_00520       CDS       T04479                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism snj  Sphingomonas sp. NIC1 Pathway snj01100   Metabolic pathways snj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A7E77_00520    00074 Mycolic acid biosynthesis     A7E77_00520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A7E77_00520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  ANC85514 LinkDB All DBs Position complement(79710..79946) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAITYIDEHKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgaccgcgtgaagaagatcgtcgtcgagcatctcggcgtcgaagcc gacaaggtgaccgaggacgcgagcttcatcgacgacctgggcgccgacagcctcgacatc gtcgagctcgtcatggcgttcgaggaagagttcggggtcgagatccccgacgatgccgcc gagaagatcacgaccgtcaaggacgcgatcacctacatcgacgagcataaggcgtaa

DBGET integrated database retrieval system