KEGG   Sphingomonas sp. NIC1: A7E77_06610
Entry
A7E77_06610       CDS       T04479                                 
Name
(GenBank) ATP-dependent Clp protease adapter ClpS
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
snj  Sphingomonas sp. NIC1
Brite
KEGG Orthology (KO) [BR:snj00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    A7E77_06610
SSDB
Motif
Pfam: ClpS
Other DBs
NCBI-ProteinID: ANC86590
LinkDB
Position
complement(1359920..1360261)
AA seq 113 aa
MAERRDDGTDDGNDGGAGTGLATKTRTRTKQPTPYRVLMLNDDYTPMEFVVLCLQRFFRM
NMEEATRVMLHVHQKGVGVCGVFSYEVAETKVGQVIDFARQNQHPLQCTLEKA
NT seq 342 nt   +upstreamnt  +downstreamnt
atggccgaacgccgcgacgacggaacggatgacggcaacgacggcggcgccggcacgggc
ctcgccaccaagacgcgcacgcgcaccaagcagccgacgccctatcgcgtcctgatgctc
aacgacgattacacgccgatggaattcgtcgtgctgtgcctgcaacgcttcttccgcatg
aacatggaagaggcgacgcgggtgatgctgcacgtccaccagaagggcgtcggggtgtgc
ggggtcttctcctatgaggtggcggagaccaaggtcgggcaggtcatcgacttcgcgcgg
cagaaccagcacccgctgcaatgcacgctggagaaggcatga

DBGET integrated database retrieval system