Sphingomonas sp. NIC1: A7E77_08025
Help
Entry
A7E77_08025 CDS
T04479
Name
(GenBank) aspartate kinase
KO
K00928
aspartate kinase [EC:
2.7.2.4
]
Organism
snj
Sphingomonas sp. NIC1
Pathway
snj00260
Glycine, serine and threonine metabolism
snj00261
Monobactam biosynthesis
snj00270
Cysteine and methionine metabolism
snj00300
Lysine biosynthesis
snj01100
Metabolic pathways
snj01110
Biosynthesis of secondary metabolites
snj01120
Microbial metabolism in diverse environments
snj01210
2-Oxocarboxylic acid metabolism
snj01230
Biosynthesis of amino acids
Module
snj_M00016
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
snj_M00018
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:
snj00001
]
09100 Metabolism
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
A7E77_08025
00270 Cysteine and methionine metabolism
A7E77_08025
00300 Lysine biosynthesis
A7E77_08025
09110 Biosynthesis of other secondary metabolites
00261 Monobactam biosynthesis
A7E77_08025
Enzymes [BR:
snj01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.2 Phosphotransferases with a carboxy group as acceptor
2.7.2.4 aspartate kinase
A7E77_08025
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AA_kinase
ACT_9
ACT_7
ACT
ACT_6
Motif
Other DBs
NCBI-ProteinID:
ANC86845
LinkDB
All DBs
Position
1663051..1664310
Genome browser
AA seq
419 aa
AA seq
DB search
MARIVMKFGGTSMAGIERIRSVAARVKREVEAGNEVAVVVSAMAGETDRLVGFCREASSL
YDPREYDVVVAAGEQITSGLLAIALQAAGAQARSWLGWQLPIHTDDAHAKARIGTIETDA
LIASMAAGEVAVIPGFQGRSEDGRVTTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYT
TDPRIVPRARKLAKVTYEEMLELASVGAKVLQTRSVGLAMKEQVRVQVLSSFTGEDAPMA
DTLPGTMIVGEEEIDDVERQLITGIAHDKNEAKITLTSVPDKPGAVAAIFEPLAAANINV
DMIIQNIAHNHGSTDVTFTVPSADLARSLEALNQGREAIGFGELVHDTRVAKISVVGVGM
RSHAGVASTMFTTLGARGINIQAISTSEIKVSVLIHEDETELAVRVLHTAYGLDAEAAA
NT seq
1260 nt
NT seq
+upstream
nt +downstream
nt
atggcacgtatcgtgatgaagttcggcggcacgtcgatggccgggatcgagcgcatccgg
agcgttgcggcgcgcgtcaaacgcgaggtggaggcgggcaacgaggttgcggtcgtcgta
tcggcgatggcgggcgagacggaccggctggtcggcttctgccgcgaagcctcgtcgctg
tacgacccacgcgaatatgacgtcgtcgtcgcggcgggcgaacagattaccagcggcctg
ctggcgatcgccttgcaggcggcaggcgcgcaggcgcgcagctggctcggctggcagctg
ccgatccacaccgacgacgcgcacgccaaggcgcggatcggcacgatcgagacggacgcg
ctgatcgccagcatggcggcgggcgaggtggcggtgatccccggcttccagggccggtcg
gaggatggccgcgtcacgacactggggcgcggcgggtcggatacgtcggcggtcgcggtc
gcggcggcggtgaaggcggaccgctgcgacatctacaccgacgtcgatggcgtctacacc
accgacccgcgcatcgtgccgcgcgcgcggaagctcgccaaggtgacgtacgaagagatg
ctggaactcgccagcgtcggcgcgaaggtgttgcagacccgatcggtcggcctcgcgatg
aaggaacaggtccgcgttcaggtgctctcgtccttcacgggcgaggacgcgccgatggcg
gatacattgcccggcacgatgatcgtcggcgaagaggagattgacgacgtggaacgccag
ctgatcaccggcatcgcgcacgacaagaacgaagcgaagatcacgctgacctccgtcccc
gacaagccgggcgcggtggccgcgatcttcgaaccgctcgcggcggcgaacatcaacgtc
gacatgatcatccagaatatcgcgcacaaccacggttcgaccgacgtcaccttcacggtg
ccgtccgcggatctggcgcgcagcctcgaggcgctgaatcaggggcgcgaggcgatcggc
ttcggcgagctggtccatgacacgcgcgtcgccaagatttcggtcgttggcgtcggcatg
cgcagccatgcgggcgtggcgagcacgatgttcaccacgctcggcgcgcgcgggatcaac
atccaggcgatctcgaccagcgagatcaaggtctcggtcctgatccacgaggatgaaacc
gagctggcggtgcgcgtgctgcacacggcctatggcctcgacgcagaggcggcggcgtga
DBGET
integrated database retrieval system