Sphingomonas sp. NIC1: A7E77_09565 Help Entry A7E77_09565       CDS       T04479                                  Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism snj  Sphingomonas sp. NIC1 Brite KEGG Orthology (KO) [BR:snj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:snj03110]     A7E77_09565    03029 Mitochondrial biogenesis [BR:snj03029]     A7E77_09565 Chaperones and folding catalysts [BR:snj03110]  Heat shock proteins   HSP10    A7E77_09565 Mitochondrial biogenesis [BR:snj03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     A7E77_09565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  ANC87124 LinkDB All DBs Position 1992631..1992918 Genome browser AA seq 95 aa AA seqDB search MNFRPLHDRVLVRRVEAEEKTAGGIIIPDTAKEKPQEGEVVAAGTGLKAEDGKVTPLDVK AGDRILFGKWSGTEVKVNGEDLLIMKESDILGIVG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaactttcgtccgttgcatgaccgcgtcctcgtccgccgtgtcgaggcggaagagaag acggctggcgggatcatcatccccgacaccgccaaggaaaagccgcaggagggcgaggtc gtcgccgccggcaccgggctgaaggccgaagacggcaaggtcacgccgctcgacgtcaag gctggcgaccgcatcctgttcggcaagtggtcgggcaccgaggtgaaggtcaacggcgaa gacctgctgatcatgaaggaaagcgacatcctcgggattgtcggctga

DBGET integrated database retrieval system