Streptomyces nitrosporeus: CP967_21515 Help Entry CP967_21515       CDS       T06889                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism snk  Streptomyces nitrosporeus Brite KEGG Orthology (KO) [BR:snk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:snk03032]     CP967_21515    03036 Chromosome and associated proteins [BR:snk03036]     CP967_21515    03400 DNA repair and recombination proteins [BR:snk03400]     CP967_21515 DNA replication proteins [BR:snk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CP967_21515 Chromosome and associated proteins [BR:snk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CP967_21515 DNA repair and recombination proteins [BR:snk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CP967_21515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG A_thal_3526 Motif Other DBs NCBI-ProteinID:  QEU76678 UniProt:  A0A5J6FJU7 LinkDB All DBs Position 4844322..4844603 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAALAETVGEVVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPINIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgccctggccgaccgtgccgaggtgacccgcaaggac gccgacgccgttctggccgcgctcgccgagaccgtcggcgaggtcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gctcgtaacccgcagaccggcgacccgatcaacatcccggccggctacagcgtgaaggtc tccgcgggctcgaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system