Sphaerotilus sulfidivorans: EWH46_14265 Help Entry EWH46_14265       CDS       T06182                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism snn  Sphaerotilus sulfidivorans Pathway snn01100   Metabolic pathways snn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EWH46_14265    00074 Mycolic acid biosynthesis     EWH46_14265   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EWH46_14265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1896 Motif Other DBs NCBI-ProteinID:  QEN01823 UniProt:  A0A5C1Q181 LinkDB All DBs Position 3151543..3151779 Genome browser AA seq 78 aa AA seqDB search MSDIEARVKKIIAEQLGVAEEEVTAEKAFVADLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQAAIDYAKANQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgaagcacgcgtcaagaagatcattgccgaacaactcggtgtggccgag gaagaagtgacggccgagaaggcctttgtcgccgatctgggcgccgactcgctggacacc gtcgagctggtcatggccctggaagacgagttcggcatcgagatcccggacgaggaagcc gagaagatcaccaccgtccaggccgcgatcgactacgccaaggccaaccaggcctga

DBGET integrated database retrieval system