KEGG   Streptomyces nodosus: CP978_00055
Entry
CP978_00055       CDS       T06839                                 
Name
(GenBank) aspartate aminotransferase family protein
  KO
K20435  validone 7-phosphate aminotransferase [EC:2.6.1.-]
Organism
snq  Streptomyces nodosus
Pathway
snq00525  Acarbose and validamycin biosynthesis
snq01100  Metabolic pathways
snq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    CP978_00055
Enzymes [BR:snq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     CP978_00055
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: QEV42989
UniProt: A0A5P2WHZ0
LinkDB
Position
complement(12682..13956)
AA seq 424 aa
MTTTKRLPAPQDAAQYQLGDIMLVRGEGIRAWDAEGREFLDCVSGTFNLLLGHNHPEVMA
AVREQTERLVFASSSFQTEPTNRVVQELAAISPPNLTRINLRSSSGSTANEGAIKMAQLH
TGRRDVIVPFRAHLGQSLATASLNGTTKMRAPFPHRYPGSLHVPGPYCFRCFYRQTPESC
GMLCVDRIEDFITYASSGSVACVVIEPISGAGGNIVPPDGYLQELRRFCDDREIVLIFDE
IQTGLGRTGQMFAADHFGVQPHMMTLAKGLTGSGLPMAAILTEERMAGWDRSLHSFTYGS
HTLSAAAALATLEIVQRPGFLENVRASGDVLLDRLRDLQKDNPVIGDVRGVGLMIGVELV
EPDGTKAVARAHAYQRSLQDHGILTRVSEHGDGSTIELRPPLILTPADAHTVADRFGEAL
EAVA
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgacaacgacaaaacgcctccctgcgccgcaggacgcggctcagtaccagttaggcgac
atcatgctggtacgtggtgagggtatccgcgcctgggacgccgaggggcgcgagtttctc
gactgcgtttctggcacctttaacctgctgctcggacacaaccacccggaggtgatggcc
gcagtacgggaacagaccgagcggctcgtcttcgccagttcgtccttccagaccgaaccc
accaaccgggtagtccaagagctggctgccatcagcccgcccaacctcacacggatcaac
ctgcgcagttccagtggctccaccgccaacgaaggcgccatcaagatggcccagctccat
accggccgtcgcgacgtcatcgtgcctttccgcgcccacctcggccagagtctcgcgacg
gcgagcctcaacggcaccaccaaaatgcgcgcaccgtttccgcaccgctaccccggcagc
cttcacgtgccaggcccctactgcttccgctgcttctaccgccagacccccgagagttgc
ggcatgctctgcgtcgaccgcatcgaggacttcatcacctacgctagctccggcagcgtg
gcctgcgtggtgatcgagccgatcagcggcgctggcggcaacatcgtcccgcccgacggc
tacctccaagagttgcgtcggttctgcgacgatcgtgagatcgtgctcatcttcgacgag
atccagaccgggctgggccgcaccggacaaatgttcgccgccgaccacttcggtgtccag
ccgcacatgatgaccctcgcgaagggactcaccggaagcggcctccccatggccgccatc
ctcaccgaggaacgcatggccggctgggaccgtagcctgcacagcttcacctacggtagc
cacaccctgtcggctgcggccgccctggccaccctggaaatcgtccagcgccccggcttc
ctggagaacgtacgggccagcggcgacgtgctcctggaccggctgcgggacctccagaag
gacaaccccgtgatcggcgacgtccgaggggtcggcctgatgatcggggtcgagctggtg
gagcccgacggcaccaaggccgtcgcccgtgcccacgcctaccaaaggtcgctccaggac
cacggcattctcacccgtgtctccgagcacggagacggcagcacgatcgaactgcgccca
cctctcatccttacacctgccgacgcccacacggttgctgaccggttcggcgaggcgctg
gaggccgtcgcatga

DBGET integrated database retrieval system