Streptomyces nodosus: CP978_18460 Help Entry CP978_18460       CDS       T06839                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism snq  Streptomyces nodosus Pathway snq03060   Protein export snq03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:snq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CP978_18460  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CP978_18460  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:snq02044]     CP978_18460 Secretion system [BR:snq02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CP978_18460 SSDB OrthologParalogGFIT Motif Pfam:  TatA_B_E DUF4834 60KD_IMP DUF948 TrbL_3 HTH_43 Motif Other DBs NCBI-ProteinID:  QEV40266 LinkDB All DBs Position 4091261..4091491 Genome browser AA seq 76 aa AA seqDB search MFGMSELAVILLVVIVLVGMKKLPELMRAAGKATRILKSEMKALNEKDAKAHQRQHHTSR AARGTTAKQHKPSGRS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgttcggcatgagtgagctggccgtgatcctccttgtggtgatcgtgctggtcgggatg aagaagctcccggaactgatgcgtgcggcgggcaaggcgacacggatcctcaagagcgag atgaaggcgctcaacgagaaggacgccaaggcgcatcagcgtcagcatcacacgagccgt gccgcgcgggggacgacggcgaagcagcacaagcccagcggccgttcctga

DBGET integrated database retrieval system