Streptomyces nodosus: CP978_29115 Help Entry CP978_29115       CDS       T06839                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism snq  Streptomyces nodosus Pathway snq00998   Biosynthesis of various antibiotics snq01100   Metabolic pathways snq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP978_29115    00074 Mycolic acid biosynthesis     CP978_29115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP978_29115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEV42087 UniProt:  A0A0B5DIP3 LinkDB All DBs Position complement(6578925..6579188) Genome browser AA seq 87 aa AA seqDB search MTSQPIEKLNKEELRQTLADVIDVDATEIGEATDFVEELQVDSLLLLELVVVLEKKYQVK FTEQEMRTARTFHEALALLQRKLAVSI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacgtcacagcccatcgagaagctgaacaaggaagaacttcggcagaccctggccgat gtgatcgatgtcgacgccaccgagatcggtgaggcgaccgacttcgtggaggagttgcag gtcgactcgctgctgctgctggaactggtcgtggtgctggagaagaagtaccaggtcaag ttcaccgagcaggagatgcgaacggcccgcaccttccatgaggcgctcgcgctgctgcag cggaagctggcggtgtcgatatga

DBGET integrated database retrieval system