Streptomyces nodosus: CP978_29160 Help Entry CP978_29160       CDS       T06839                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism snq  Streptomyces nodosus Pathway snq00261   Monobactam biosynthesis snq01100   Metabolic pathways snq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP978_29160  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snq01008]     CP978_29160 Polyketide biosynthesis proteins [BR:snq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP978_29160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV42096 UniProt:  A0A0B5DSM3 LinkDB All DBs Position 6587787..6588008 Genome browser AA seq 73 aa AA seqDB search MSTNPFEDNDASYYVLVNDEGQHSLWPAFAEVPAGWTVAHGQDSREACLEYVDKNWTDMR PLSLVREMEAAGK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatcctttcgaggacaacgacgccagctactacgtgctggtcaatgacgag ggacagcattcgctgtggccggccttcgccgaggtcccggccggctggacggtcgcgcac ggccaggacagccgcgaggcgtgcctggagtacgtcgacaagaactggaccgacatgcgg ccgctcagcctggtgcgtgagatggaggccgccggaaagtaa

DBGET integrated database retrieval system