Streptomyces niveus: BBN63_01105 Help Entry BBN63_01105       CDS       T04887                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism snw  Streptomyces niveus Pathway snw00998   Biosynthesis of various antibiotics snw01100   Metabolic pathways snw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BBN63_01105    00074 Mycolic acid biosynthesis     BBN63_01105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BBN63_01105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  AQU65067 UniProt:  A0A1U9QLL1 LinkDB All DBs Position 258726..258974 Genome browser AA seq 82 aa AA seqDB search METALERVREIVVYVLPEIQADITAGDRLEADLGIDSLSLVEILVQVEKRFFLTLDDSEM IDVESVQDILDIIQRREAVAGV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggaaacggcactggagagagtgcgggaaatcgtcgtctacgtactgccggagatccag gcggacatcaccgccggggaccggctcgaagcggacctgggaatcgactccctctcgctg gtcgagattctcgtccaggtggagaagcgcttcttcctcacgctcgacgacagcgagatg atcgacgtcgagagcgttcaggacattctggacatcatccagcgccgagaggcagtggcc ggcgtctga

DBGET integrated database retrieval system