Streptomyces niveus: BBN63_10025 Help Entry BBN63_10025       CDS       T04887                                  Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism snw  Streptomyces niveus Pathway snw00190   Oxidative phosphorylation snw01100   Metabolic pathways Module snw_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:snw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BBN63_10025  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:snw00194]     BBN63_10025 Photosynthesis proteins [BR:snw00194]  Photosystem and electron transport system   F-type ATPase [OT]    BBN63_10025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AQU66538 UniProt:  A0A1U9QQH9 LinkDB All DBs Position complement(2401990..2402244) Genome browser AA seq 84 aa AA seqDB search MSAALELVNLASAKTTVVGNVASIGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLIRT NQIMGFAFCEALALIGIVMGFVYQ NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtccgctgctctcgaattggtcaacctcgcctccgccaagacgaccgtcgtcggcaac gtcgcgtccatcggctacggtctcgccgcgatcggccccggcgtcggcgtcggcatcatc ttcggtaacggcacccaggccctcgcccgtcagcccgaggcggccggcctgatccgcacc aaccagatcatgggtttcgccttctgtgaggcgctcgccctcatcggcatcgtcatgggc ttcgtctaccagtaa

DBGET integrated database retrieval system