Streptomyces niveus: BBN63_10810 Help Entry BBN63_10810       CDS       T04887                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism snw  Streptomyces niveus Brite KEGG Orthology (KO) [BR:snw00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     BBN63_10810 Enzymes [BR:snw01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      BBN63_10810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 GST_N_3 Thioredoxin Glrx-like Ank_KRIT1 Motif Other DBs NCBI-ProteinID:  AQU66664 UniProt:  A0A1U9QQW8 LinkDB All DBs Position 2575998..2576240 Genome browser AA seq 80 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKGQMDREGIAYTEINIEQDPDSAAFVEKANGGNQTVPTLLF DDGSTLTNPSLAQVKQKVGA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccggggaccgtgacgatgtacagcaccacatggtgcggatactgccgtcggctcaag ggccagatggaccgcgaaggcatcgcgtacaccgagatcaacatcgagcaggacccggat tcggcggcgttcgtcgagaaggcgaacggtggcaatcagacggtcccgaccctgctcttc gacgacggatcgacgttgacgaacccgtctctcgcgcaggtcaagcagaaggtcggcgcc tga

DBGET integrated database retrieval system