Streptomyces nigra: DC008_18830 Help Entry DC008_18830       CDS       T05839                                  Name (GenBank) translocase   KO K03116   sec-independent protein translocase protein TatA Organism snz  Streptomyces nigra Pathway snz03060   Protein export snz03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:snz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     DC008_18830  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     DC008_18830  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:snz02044]     DC008_18830 Secretion system [BR:snz02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    DC008_18830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AWE51541 LinkDB All DBs Position complement(4064020..4064238) Genome browser AA seq 72 aa AA seqDB search MFGLSEIAIILIVVIAVLCAKKLPELTRSAGKSARILKAEARAMKDEDDGERAAPRVIPG ETVTPRPDEPKA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgttcggactgagcgagatcgcgatcatcctcatcgtcgtcatagccgtcctctgcgcc aagaagctccccgaactgacccgctcggcgggcaagtcggcgcgcatcctcaaggccgag gcccgggcgatgaaggacgaggacgacggcgagcgggccgctccgcgggtgatcccgggc gagacggtcaccccgcgcccggacgagccgaaggcatga

DBGET integrated database retrieval system