Sulfuriroseicoccus oceanibius: G3M56_009775 Help Entry G3M56_009775      CDS       T07818                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism soa  Sulfuriroseicoccus oceanibius Pathway soa01100   Metabolic pathways soa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:soa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G3M56_009775 (acpP)    00074 Mycolic acid biosynthesis     G3M56_009775 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G3M56_009775 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QQL44182 UniProt:  A0A6B3L355 LinkDB All DBs Position complement(2424298..2424537) Genome browser AA seq 79 aa AA seqDB search MSDSIEQKVKDIIVEQLSVTPEQVTPEAKFIDDLGADSLDTVELVMAFEEEFGIDVPDEE AEKLTSVGAVISYVESAQG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgatagcatcgagcaaaaagtcaaagacatcatcgtggagcagcttagcgtgact cctgagcaagtgacaccagaagccaagttcatcgatgatcttggtgcagattccctcgac accgtcgagctggtgatggccttcgaagaagagtttggcatcgacgtgccagacgaagag gcagagaagctgacttcggttggtgctgtgatctcctacgttgagtcggcacagggctaa

DBGET integrated database retrieval system