KEGG   Sulfuriroseicoccus oceanibius: G3M56_010665
Entry
G3M56_010665      CDS       T07818                                 
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
soa  Sulfuriroseicoccus oceanibius
Pathway
soa00260  Glycine, serine and threonine metabolism
soa00750  Vitamin B6 metabolism
soa01100  Metabolic pathways
soa01110  Biosynthesis of secondary metabolites
soa01120  Microbial metabolism in diverse environments
soa01230  Biosynthesis of amino acids
Module
soa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:soa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G3M56_010665
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    G3M56_010665
Enzymes [BR:soa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     G3M56_010665
SSDB
Motif
Pfam: PALP TPP_enzyme_N
Other DBs
NCBI-ProteinID: QQL44343
UniProt: A0A6B3L2P0
LinkDB
Position
complement(2635204..2636301)
AA seq 365 aa
MSQTSVPKILHDRGVISRYREFLPVSDATPVVSLNEGSTPLIHVPKLSALAGAQRQVFIK
YEGLNPTCSFKDRGMTLAISKAAEEGAKMVICASTGNTSAAAAAYAVRAGMRCVVLLPAG
KISMGKLAQAVVYGADVVAIDGNFDDALELVRELGQRDGIAVVNSINPFRIEGQKTASFE
VIDELGDAPTVHCLPVGNAGNITAYWKGYREYHLAGKSSALPMVWGAQAEGAAPIVRGEV
VTNPETVATAIRIGNPASWKGANEAIEQSGGMIRALSDDKLLEAQAWLAANEGIFVEPAS
AASVGCLLAAIDEGLVAKLPDTATVVCTVTGHGLKDIDTPMEFAGGGKILEAGASADSVL
GVLGM
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagtcagacctccgtccccaagattcttcacgaccgcggcgtgatttcccgctaccgc
gagtttttgcctgtgagcgacgccacaccggtggtgtcgttgaacgagggctcgacgcca
ctcatccacgtgccgaagttgtcggctctggctggagctcagcgtcaggtcttcatcaag
tatgagggcttgaacccgacgtgttcgttcaaggaccgcgggatgacgttggcgattagc
aaagcggccgaggaaggtgccaagatggtgatctgtgcctcgactggcaacacttcggcg
gcggcggcggcgtacgcggtgcgtgccgggatgcgttgtgtcgtgcttttgcctgcgggc
aagatctcgatgggcaagcttgcgcaggcggtggtttacggtgccgatgtcgtagcgatc
gatggaaattttgatgatgcgctcgaattggtgcgcgagttggggcagcgcgatggcatt
gcggtggtcaactcgatcaacccattccgtatcgaagggcagaagaccgcatcgtttgaa
gtgatcgatgagttgggggatgctccgaccgtgcactgtcttccagttggcaatgcgggt
aatatcactgcctattggaaaggctatcgggagtaccatctggctgggaagtcgagtgcg
ttgccgatggtgtggggtgctcaggctgagggggctgcgccaattgtgcgtggtgaggtt
gtgaccaacccggagacggtagccaccgcgattcggatcggtaatccggcgagttggaag
ggcgcgaacgaagcaatcgagcagtcgggtggaatgatccgcgcgctgagcgacgacaag
ttgcttgaggcgcaggcgtggttggccgccaacgaagggatcttcgtggagcctgccagt
gcggcgtctgtaggctgtttgctggcagcgattgatgaaggtctggttgcaaagttgcct
gacaccgctaccgtcgtttgcaccgtgactggtcacggactcaaggatattgacacgccg
atggaatttgctggtggtggaaaaattctcgaggccggggcatccgcggattccgtgctg
ggcgtgctggggatgtag

DBGET integrated database retrieval system