Solenopsis invicta (red fire ant): 105194618 Help Entry 105194618         CDS       T03916                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism soc  Solenopsis invicta (red fire ant) Pathway soc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:soc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105194618  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:soc04121]     105194618    03400 DNA repair and recombination proteins [BR:soc03400]     105194618 Ubiquitin system [BR:soc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      105194618    Cul5 complex      105194618 DNA repair and recombination proteins [BR:soc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      105194618 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  105194618 NCBI-ProteinID:  XP_011157927 LinkDB All DBs Position 12:complement(9525129..9527320) Genome browser AA seq 117 aa AA seqDB search MDVFLMIRRKKSTIFTDAKDDTTVLELKKMIEGILKIPPVNQQLFNKDNLLMSDNKTLQD YGLTSSTAKAQCPALVGLAVRQPDGQFEPLEMTPFSLPPDLPDVMKSQENNGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttttaatgatcaggcgaaaaaaatcaacgatatttaccgacgcgaaggat gataccacggtgctcgagttgaagaagatgattgaaggtatattgaaaatcccacctgta aatcaacagctgtttaacaaggacaatcttctcatgtcggacaacaaaactttacaagat tatggactgacatcgtcaactgcgaaagcacaatgtcctgcattagttggtttagccgtg cgccaacctgatggccagtttgaacctctcgaaatgacaccgttctcactaccgccggat ctccctgacgttatgaagtcccaggaaaacaatggccaagagcagtctccttga

DBGET integrated database retrieval system